Order Rabbit SOCS1 antibody 02021960842 at Gentaur SOCS1
495 EUR
50 ug
70R-5877
NA
WB
Human
1 mg/ml
Blue Ice
anticorps
Primary Antibodies
Oryctolagus cuniculus
Cytokines & Growth Factors
Purified Polyclonal Antibodies
SOCS1 antibody was raised against the middle region of SOCS1
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOCS1 antibody in PBS
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.