Product description


Order SOCS1 antibody 01011960842 at Gentaur SOCS1


475 EUR


50 µg

Catalog no



Tested for


Cross Reactivity


Raised in



1 mg/ml

Shipping conditions

Blue Ice

French translation


Usage Recommendations

WB: 1 ug/ml


Primary Antibody

Method of Purification

Affinity purified

Area of research

Cytokines & Growth Factors

Antibody Subtype

Polyclonal Antibodies, Purified


SOCS1 antibody was raised against the middle region of SOCS1

Form & Buffer

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOCS1 antibody in PBS


Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.


If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Assay Information

SOCS1 Blocking Peptide, catalog no. 33R-8127, is also available for use as a blocking control in assays to test for specificity of this SOCS1 antibody

Type of Immunogen

SOCS1 antibodies were raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA

Additional Information

This is a rabbit polyclonal antibody against SOCS1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at