Order SOCS1 antibody 01011960842 at Gentaur SOCS1
475 EUR
50 µg
70R-5877
WB
Human
Rabbit
1 mg/ml
Blue Ice
anticorps
WB: 1 ug/ml
Primary Antibody
Affinity purified
Cytokines & Growth Factors
Polyclonal Antibodies, Purified
SOCS1 antibody was raised against the middle region of SOCS1
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SOCS1 antibody in PBS
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
SOCS1 Blocking Peptide, catalog no. 33R-8127, is also available for use as a blocking control in assays to test for specificity of this SOCS1 antibody
SOCS1 antibodies were raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
This is a rabbit polyclonal antibody against SOCS1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com